TB500 (Thymosin Beta 4)
£28.00
9 in stock
TB-500 (5mg) – Premium Research Grade Peptide
TB-500 (2mg) is a high-purity synthetic peptide designed for advanced laboratory research in biological, cellular, and structural signalling pathways. Specifically engineered to replicate the active domain of Thymosin Beta-4, TB-500 is a primary choice for studies focusing on actin regulation, cell migration, and tissue regeneration mechanisms.
At Ankh Peptides UK, we prioritise scientific integrity. Every vial of TB-500 is batch-tested to ensure high purity and consistency for reproducible laboratory results.
Product Specifications
-
Product Name: TB-500 2mg
-
Sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES -
Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
-
Molecular Weight: 4963.4 g/mol
-
Purity: ≥98% (HPLC Tested)
-
Form: Lyophilised Solid (Freeze-Dried Powder)
Storage & Handling Guidelines
To maintain maximum chemical stability and prevent degradation:
-
Unreconstituted: Store the sealed, lyophilised vial at -20°C, away from direct light and moisture.
-
Reconstituted: Once reconstituted in a suitable research solvent (e.g., Bacteriostatic Water or Sterile Water for Injection), keep refrigerated at 2°C to 8°C and use within the appropriate experimental window.
-
Handling: Allow the vial to reach room temperature before reconstitution to avoid condensation issues.
Quality Assurance & Synthesis
Our TB-500 is produced using advanced Solid-Phase Peptide Synthesis (SPPS) techniques and undergoes rigorous quality control checks, including High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) analysis. We guarantee a minimum purity of 98%, delivering the consistency and precision modern scientific exploration demands.
Compliance & Laboratory Safety Disclaimer
FOR LABORATORY AND RESEARCH USE ONLY
Products supplied by Ankh Peptides UK are intended strictly for in vitro laboratory experimentation, scientific research, and analytical studies. They are not intended, designed, or licensed for human or animal consumption, medical treatment, cosmetic application, or therapeutic clinical use. All handling must be conducted by qualified personnel using standard laboratory safety protocols.
